PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07493g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 219aa    MW: 24906.3 Da    PI: 9.1243
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07493g01001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.34.8e-1786139957
                               HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                  Homeobox   9 keqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                               ++q+ +Le l++   r+p+a+++e+++ +l    +++ ++V++WFqN++a+e++
  Niben101Scf07493g01001.1  86 SSQIGILEMLYRGgMRTPNAQQIEQITVQLakygKIEGKNVFYWFQNHKARERQ 139
                               68**********99**************************************97 PP

2Wus_type_Homeobox99.42.7e-32861411065
         Wus_type_Homeobox  10 peQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                               ++Qi iLe+ly+ G+rtPn+++i++it +L++yGkie+kNVfyWFQN+kaRerqkq
  Niben101Scf07493g01001.1  86 SSQIGILEMLYRGGMRTPNAQQIEQITVQLAKYGKIEGKNVFYWFQNHKARERQKQ 141
                               57****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003890.003981144IPR001356Homeobox domain
SuperFamilySSF466894.71E-985145IPR009057Homeodomain-like
PfamPF000468.5E-1586139IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.0E-686139IPR009057Homeodomain-like
PROSITE profilePS500719.31388140IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MYMGSSSGSL SMKVHEFTRG LMLEHDSAAP SLTLGCKRLR PLAPKLSSCT NDPTIVTPPF  60
DLKSFIRPES STSPGKTSFN DDKKDSSQIG ILEMLYRGGM RTPNAQQIEQ ITVQLAKYGK  120
IEGKNVFYWF QNHKARERQK QKRNSLGLSP SPRTPPAIVT SPLSFDTRGE VVREEDSPYK  180
RKCIGWTYEY LEEEEKRNCR EDNGDRTLEL FPLHPEGMR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776871.11e-146PREDICTED: WUSCHEL-related homeobox 4
RefseqXP_016488708.11e-146PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J91e-61WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLC0IN091e-129C0IN09_PETHY; WOX4
STRINGPGSC0003DMT4000206621e-118(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61862335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.19e-62WUSCHEL related homeobox 4